l 17 j i 2011le 17 janvier 2011 mdelpechmarc .`1958 heller : fi¨vre m©diterran©enne...

Download L 17 j i 2011Le 17 janvier 2011 MDELPECHMarc .`1958 Heller : Fi¨vre M©diterran©enne Familiale

Post on 12-Sep-2018

215 views

Category:

Documents

0 download

Embed Size (px)

TRANSCRIPT

  • 53me Journes de Biologie Clinique Necker Pasteur

    L 17 j i 2011Le 17 janvier 2011

    M DELPECHMarc DELPECH

  • Les fivres hrditaires

  • 1945 Siegal : Pritonite paroxystique bnigne1948 Reinman : Description dun groupe htrogne daffections cycliques1951 Cattan : Description de la maladie priodique1958 Heller : Fivre Mditerranenne Familiale , critres de diagnostic1967 S h L FMF l di h di i 1967 Sohar La FMF est une maladie hrditaire transmission autosomique rcessive1992 Pras : Localisation du gne sur le bras court1992 Pras : Localisation du gne sur le bras court du chromosome 16

  • Fivre mditerranenne familialeFivre mditerranenne familialeAutosomique rcessiveAutosomique rcessive

    Accs paroxystiques fivreAccs paroxystiques fivrepolysritemonoarthritemonoarthritedermohypodermitesplnomgaliesplnomgalie

    Amylose inflammatoire AA reinAmylose inflammatoire AA reintube digestifcur cur thyrode

  • La fivre hibernienne, renomme ultrieurement ,TNFRSF1A Associated Periodic Syndrome (TRAPS)( )

    Le syndrome dhyper Ig-D (HIDS)y yp g ( )

    Le syndrome de Muckle et Wells (MWS)y ( )

  • Fivres rcurrentes hrditairesFivres rcurrentes hrditairesFMFFMF HIDSHIDSMWSMWS TRAPSTRAPS

    Dure accs (j)Dure accs (j) 33--44 11--22 77 2121 33--77(j)(j)

    Douleurs abdo.Douleurs abdo.

    11--22 77--2121

    ++++ ++++++++--

    Douleurs artic.Douleurs artic.

    Signes cut.Signes cut.

    ++++ ++++++ ++

    (rash)(rash) rash ++rash ++++++urticaireurticaire

    AmyloseAmylose ++++ ++++ ++ --

    SurditSurdit ++ -- ----

    ColchicineColchicine ++ ?? -- --

    TransmissionTransmission A.RA.R A.DA.D A.DA.D A.RA.R

  • 283 361 353 070 45 33702617 53 43 51 52 34 4752622323 154 80

    SEFARADES 6 4 3 3 5 3 7 A 5 G AAA9 (18) 9 5 2 9 2

    ARABES 1 9 5 8 2 5 3 7 A 5 G AAA 9 11 6 2 6 2

    TURCS 5 8 2 5 3 7 A 5 G AAA 9 9 5 3 9 2

    ARMENIENS 1 5 8 2 5 3 7 A 5 G AAA 9 9 5 3 9 2ARMENIENS 1 5 8 2 5 3 7 A 5 G AAA 9 9 5 3 9 2

    ARMENIENS 2 5 8 9 5 5 N6 A 6 A A 7 9 5 5

    ARMENIENS 3 5 8 7 5 5 N6 C 5 A A 4 11 5 6 9

    DRUZES 8 7 5 5 N6 C 4 A A 8 11 5 5 9 5

    ARABES 2 7 3 6 2 7 9 6 C 5 A A 6 9 5 6 7

  • Un consortium franaisUn consortium franais Marenostrine

    Un consortium internationalUn consortium international Pyrin

  • B-box coiled-coilB30-2bZIP NLS

    266-280408 594 598 774

    781

    interaction ADN-protine: bZIP

    375408 594 598 774

    interaction ADN protine: bZIP

  • La famille des protines B30-2pB-box B30-2bZIP

    marnostrinecoiled-coil B30-2bZIP

    m

    f R /SSARing F

    rfp, Ro/SSAStaf-50

    mid1

    rpt-1rpt 1

  • Expression de MEFV au coursd l diff ti ti lde la diffrentiation granuleuse (cellules HL-60)

    heures

    MEFVMEFV

    actine

    Tidow N, 2000

  • L110PM694VM694IS675N

    R653H

    R42W

    L110PE148V

    T267IE230K

    E167DE148Q

    M694I

    V726A

    K695R

    A744S

    V704I

    694delMM680I

    S675N

    M680L

    Y688XT681I

    G678E

    F479LQ440E I591TP369SR42WA89T

    10987654321

    T267IR761HA744S

    692delIY688X

  • 2 i 1 i 0 i2 mutations 1 mutation 0 mutation45% 15% 40%

  • Pseudo-dominance

    Un autre gne responsable dun syndrome similairesimilaire

  • Cazeneuve et al Am J Hum Genet 1999 65:88-97azeneuve et al Am J Hum Genet 999 65 88 97

  • M694V/M680I M680I/V726AM694V/V726AV726A M694V/M680I M680I/V726A

    M694V/V726AM694V/M680I M694V

    M694V/M680IM680I/M680I

    M694V/M680I

    Cazeneuve et al Am J Hum Genet 1999 65:88-97

  • Juifs spharades 37%Juifs spharades 37%

    Juifs ashknases 8%

    Turcs 12%

    A b 10%Arabes 10%

    ArmniensArmniensArmnie 24%Californie 0%Californie 0%

  • Amylose AA/gnotype Amylose AA/gnotype MEFVMEFVEtude faite chez des Armniens souffrant de FMF

    et damylose AA et non traits par la colchicine

    M694V/M694V 10/10M694V/V726A 1/8M694V/V726A 1/8M694V/M680I 2/4M680I/V726A 2/3V726A/V726A 1/3V726A/V726A 1/3

    Cazeneuve et al Am J Hum Genet 1999 65:88-97

  • Facteurs de risque d'amylose dans la FMF

    malades atteints Odd's ratio pd'amylosed amylose

    gnotype MEFV M694V/M694V 58,5 (24/41) 6,8 (2,7-17,8) 0,0001M 9 V/M 9 V , ( / ) , ( , , ) ,autres 24,0 (24/96) 1

    sexeH 43,5 (35/80) 4,0 (1,5-18) 0,003F 21 1 (12/57) 1F 21,1 (12/57) 1

    gnotype SAA1g yp/ 59,5 (22/37) 6,9 (2,5-19) 0,001autres 25 (25/100) 1( )

    Cazeneuve et al, 2000

  • Fivre priodique avec hyper IgDFivre priodique avec hyper IgD

    16 familles

    Analyse de liaison gntique

    Localisation du gne en 12q24

    Un n c ndid t c d nt l mv l n t Un gne candidat codant la mvalonate kinase dont le dficit complet est la cause de lacidurie mvaloniquecause de l acidurie mvalonique

  • Acidurie mvalonique/HIDSAcidurie mvalonique/HIDS

    activit de la MVK mvalonaturie

    normale 100% nullenormale 100% nulle

    HIDS 10% leve au cours des accs

    acidurie

  • MUTATIONS DE LA MEVALONATE KINASEacidurie

    397 aa ARNm 1 9 kb

    H20PT243IL264F

    aciduriemvalonique

    397 aa ARNm 1,9 kb43 kDa gne > 18kb 11 exons

    L265PI268TN301TV310MA334T

    PTS 2 fixation ATP

    Dltion exon 1 Dltion exon 4A334T

    PTS 2K E DE

    1931913#

    204

    ##### ## #

    V377IG326RG202RL39P S135LT209A S272

    R277CK13X

    G309SR215QH20PH20N

    P167L I268T

    A148T T209A S272FY149X

    W62X

  • Acidurie mvalonique/HIDSq /

    Acidurie mvaloniqueAcidurie mvalonique

    HIDSHIDS

  • Actoactyl-CoA Actyl-CoA

    HMG CoA

    MvalonateMvalonate

    5 Phosphomvalonate

    Mvalonate kinase

    5-Phosphomvalonate

    FarnsylFarnsyl

    h l l l h l Ubiquinone Cholestrol Dolichol Ubiquinone Hme

  • Fivre HibernienneFivre Hibernienne

    7 familles

    Analyse de liaison gntique

    Localisation du gne en 12p13

    U did d l Un gne candidat codant le rcepteur

    TNFRSF1ATNFRSF1A

    McDermott 1999, Cell

  • TNFRSF1A

    S-SS-S S-S

    CRD1TNFRSF1A

    CRD1S-S S-S

    VCPQGKYIHPQNNSI C CTKCHKGTYLYND CPGPGQDTDC R

    CRD2

    CRD3

    CRD4

    S-S

    CRD4Y20H H22T C30S

    C30RC33YC33G

    T50MP46L

    C43YC52FCRD2

    S-S S-S

    ECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCDeathDeathDomain

    C55S L67P C70Y S86P C88RC88Y

    R92PR92Q

    C96YQ

  • Dans le mme article Mc Dermott et D. Kastner proposent le terme de syndrome

    auto-inflammatoire pour dsigner les fivres hrditaires

  • Syndrome de Muckle-WellsSyndrome de Muckle WellsAccs paroxystiques fivre 38CAccs paroxystiques fivre 38 C

    urticairearthritesarthritesconjonctivite

    Amylose inflammatoire AA reintube digestiftube d gest fthyrode

    Surdit de perception

  • Urticaire au froid familiale ou FCAS:familial cold autoinflammatory syndrome

    Autosomique dominanteDbut dans lenfanceSurvient plusieurs heures aprs uneexposition gnrale au froidDure en heures ou joursruption maculopapuleux

    FivreArthralgies Conjonctivite

  • Syndrome de Muckle-Wells

    3 familles

    Analyse de liaison gntique

    L li ti d 1 44Localisation du gne en 1q44

    Co-localisation avec lurticaire au Co-localisation avec l urticaire au froid familial (FCU)

  • La cryopyrineGne CIAS1/NALP3/PYPAF1

  • Muckle et Wells (MWS)( )Urticaire au froid familial (FCU)Chronic neurologic cutaneous and Chronic neurologic cutaneous and articular syndrome (CINCA) / (neonatal-onset multisystem inflammatory disease)onset multisystem inflammatory disease)(NOMID)

    G m difi tGnes modificateurs

  • Responsables de formes dominantesResponsables de formes rcessivesp

  • Structures de protines contenant un domaine Structures de protines contenant un domaine PyrinPyrin

    MarenostrinMarenostrin//PyrinPyrin Pyrin b zip B box B30.2

    Pyrin CARDASCASCAApoptosispoptosis associatedassociated Pyrin CARDAApoptosispoptosis--associatedassociatedSSpeckpeck--likelike proteinproteincontainingcontaining a a CCaspaseaspaserecruitmentrecruitment domaindomain

    iC iC i

    recruitmentrecruitment domaindomain

    Pyrin NBDLRR

    CryopyrinCryopyrin

  • Colocalisation pyrine/ASCColocalisation pyrine/ASC

    pyrineASC pyrine/ASC

    Richards N, 2001

  • Interaction pyrine/ASC

    pyrine pyrine

    ASC ASCASC

    Richards N, 2001avant arrire

  • Voie de signalisation de la Voie de signalisation de la PyrinPyrin//MarenostrineMarenostrine

    Marenostrin/PyrinMarenostrin/Pyrin

    ASCASC CARD PyrinPyrin b zip B box B30.2

    CaspaseCaspase--11CaspaseCaspase--1 1 activationactivation

    ILIL--11 processing processing and secretionand secretion

    ApoptosisApoptosis InflammationInflammation

    and secretionand secretion

  • Voies de signalisation impliquant la Voies de signalisation impliquant la CryopyrineCryopyrine

    CryopyrineCryopyrine

    ASCASC CARD Pyrin

    Pyrin NBDLRR

    CaspaseCaspase 11CaspaseCaspase--1 1 activationactivation

    ILIL--11 processing processing and secretionand secretion

    ApoptosisApoptosisInflammationInflammation

    and secretionand secretion

    InflammationInflammation

  • Voies de linflammation et de lapoptose

    TNFR I

    TNF

    IL1R I

    IL-1

    TNFR-I

    membrane cellulaire

    IL1R-I

    MAP3K

    membrane cellulaire

    NIK

    cascade des

    MAP3K

    MAP2K

    MAPK

    NIK

    IKK/

    caspases

    apoptose

    MAPK

    NFB

    IK

    IK

    noyau

    p p

    - AP-1 NFBP AP-1 NFB

Recommended

View more >